Recombinant Human CD32 Protein (Biotin) (C-terminal His and Avi Tag) (A330315)

Name: Recombinant Human CD32 Protein (Biotin) (C-terminal His and Avi Tag)
Brand: Antibodies.com
SKU: A330315
Price: 805.0 USD
Availability: InStock

Enlarge Image

$805

100% Guarantee

Price Match Guarantee

Alternative Formats and ConjugatesAlternative Formats

Unconjugated

Shipping Information

Freight/Packing Charges: $40

Dispatched from St. Louis, MO.

Lead Time: 7-10 business days.

Specifications

Name

Recombinant Human CD32 Protein (Biotin) (C-terminal His and Avi Tag)

Expression System

HEK293 cells

Nature

Recombinant

Protein Species

Human

Sequence

AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI

Tag

C-terminal His and Avi Tag

Conjugate

Biotin

Purity

>95% (by SDS-PAGE and HPLC).

Product Form

Lyophilized

Concentration

Reconstitution dependent.

Formulation

Lyophilized from Phosphate Buffered Saline, pH 7.4, with 8% Trehalose (0.22µm filter sterilized).

Endotoxin Level

<1 EU/µg of the protein by LAL method.

Storage

Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles.

Synonyms

8D6 antigen, 8D6A, CD320, CD320 antigen, CDw32, Fc-gamma RII-a, Fc-gamma RII-b, Fc-gamma RII-c, Fc-gamma-RIIa, Fc-gamma-RIIb, Fc-gamma-RIIc, FCG2, FCGR2A, FCGR2A1, FCGR2B, FCGR2C, FcRII-a, FcRII-b, FcRII-c, FDC-signaling molecule 8D6, FDC-SM-8D6, IGFR2, IgG Fc receptor II-a, IgG Fc receptor II-b, IgG Fc receptor II-c, Low affinity immunoglobulin gamma Fc region receptor II-a, Low affinity immunoglobulin gamma Fc region receptor II-b, Low affinity immunoglobulin gamma Fc region receptor II-c, TCblR, Transcobalamin receptor

Disclaimer

This product is for research use only. It is not intended for diagnostic or therapeutic use.

Scientific Validation DataValidation Data (4)

Enlarge Image

Recombinant Human CD32 Protein (Biotin) (C-terminal His and Avi Tag) (A330315)

Tris-Bis PAGE of Recombinant Human CD32 Protein (Biotin) (C-terminal His and Avi Tag) (A330315) under reducing conditions confirms that purity is greater than 95%.

Enlarge Image

Recombinant Human CD32 Protein (Biotin) (C-terminal His and Avi Tag) (A330315)

SEC-HPLC analysis of Recombinant Human CD32 Protein (Biotin) (C-terminal His and Avi Tag) (A330315) confirms that purity is greater than 95%.

Enlarge Image

Recombinant Human CD32 Protein (Biotin) (C-terminal His and Avi Tag) (A330315)

Rituximab binding to Recombinant Human CD32 Protein (Biotin) (C-terminal His and Avi Tag) (A330315) on a CM5 Chip via Anti-His Antibody, analyzed by surface plasmon resonance (SPR; Biacore T200). Affinity constant = 1.44 µM.

Enlarge Image

Recombinant Human CD32 Protein (Biotin) (C-terminal His and Avi Tag) (A330315)

Recombinant Human CD32 Protein (Biotin) (C-terminal His and Avi Tag) (A330315) binding to Rituximab on a CM5 Chip via Protein A, analyzed by surface plasmon resonance (SPR; Biacore T200). Affinity constant = 0.680 µM.

Publishing research using Recombinant Human CD32 Protein (Biotin) (C-terminal His and Avi Tag) (A330315)? Please let us know so that we can list the citation on this page.