+1 (314) 370-6046 or
Contact Us
  • Argentina
  • Australia
  • Austria
  • Bahrain
  • Belgium
  • Brazil
  • Bulgaria
  • Cameroon
  • Canada
  • Chile
  • China
  • Colombia
  • Croatia
  • Cyprus
  • Czech Republic
  • Denmark
  • Ecuador
  • Egypt
  • Estonia
  • Finland
  • France
  • Germany
  • Greece
  • Hong Kong
  • Hungary
  • Iceland
  • India
  • Indonesia
  • Iran
  • Ireland
  • Israel
  • Italy
  • Japan
  • Kazakhstan
  • Kuwait
  • Latvia
  • Lithuania
  • Luxembourg
  • Macedonia
  • Malaysia
  • Malta
  • Mexico
  • Monaco
  • Morocco
  • Netherlands
  • New Zealand
  • Nigeria
  • Norway
  • Peru
  • Philippines
  • Poland
  • Portugal
  • Qatar
  • Romania
  • Russia
  • Saudi Arabia
  • Serbia
  • Singapore
  • Slovakia
  • Slovenia
  • South Africa
  • South Korea
  • Spain
  • Sri Lanka
  • Sweden
  • Switzerland
  • Taiwan
  • Thailand
  • Turkey
  • Ukraine
  • UAE
  • United Kingdom
  • United States
  • Venezuela
  • Vietnam

Recombinant Human CD32 Protein (Biotin) (C-terminal His and Avi Tag) (A330314)

$805

Alternative Formats and ConjugatesAlternative Formats

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 7-10 business days.
Name
Recombinant Human CD32 Protein (Biotin) (C-terminal His and Avi Tag)
Expression System
HEK293 cells
Nature
Recombinant
Protein Species
Human
Sequence
AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSRLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI
Tag
C-terminal His and Avi Tag
Conjugate

Biotin

Purity
>95% (by SDS-PAGE and HPLC).
Product Form
Lyophilized
Concentration
Reconstitution dependent.
Formulation
Lyophilized from Phosphate Buffered Saline, pH 7.4, with 8% Trehalose (0.22µm filter sterilized).
Endotoxin Level
<1 EU/µg of the protein by LAL method.
Storage
Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles.
Synonyms
8D6 antigen, 8D6A, CD320, CD320 antigen, CDw32, Fc-gamma RII-a, Fc-gamma RII-b, Fc-gamma RII-c, Fc-gamma-RIIa, Fc-gamma-RIIb, Fc-gamma-RIIc, FCG2, FCGR2A, FCGR2A1, FCGR2B, FCGR2C, FcRII-a, FcRII-b, FcRII-c, FDC-signaling molecule 8D6, FDC-SM-8D6, IGFR2, IgG Fc receptor II-a, IgG Fc receptor II-b, IgG Fc receptor II-c, Low affinity immunoglobulin gamma Fc region receptor II-a, Low affinity immunoglobulin gamma Fc region receptor II-b, Low affinity immunoglobulin gamma Fc region receptor II-c, TCblR, Transcobalamin receptor
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Publishing research using Recombinant Human CD32 Protein (Biotin) (C-terminal His and Avi Tag) (A330314)? Please let us know so that we can list the citation on this page.

Alternative products to Recombinant Human CD32 Protein (Biotin) (C-terminal His and Avi Tag) (A330314)