+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
  • Argentina
  • Australia
  • Austria
  • Bahrain
  • Belgium
  • Brazil
  • Bulgaria
  • Cameroon
  • Canada
  • Chile
  • China
  • Colombia
  • Croatia
  • Cyprus
  • Czech Republic
  • Denmark
  • Ecuador
  • Egypt
  • Estonia
  • Finland
  • France
  • Germany
  • Greece
  • Hong Kong
  • Hungary
  • Iceland
  • India
  • Indonesia
  • Iran
  • Ireland
  • Israel
  • Italy
  • Japan
  • Kazakhstan
  • Kuwait
  • Latvia
  • Lithuania
  • Luxembourg
  • Macedonia
  • Malaysia
  • Malta
  • Mexico
  • Monaco
  • Morocco
  • Netherlands
  • New Zealand
  • Nigeria
  • Norway
  • Peru
  • Philippines
  • Poland
  • Portugal
  • Qatar
  • Romania
  • Russia
  • Saudi Arabia
  • Serbia
  • Singapore
  • Slovakia
  • Slovenia
  • South Africa
  • South Korea
  • Spain
  • Sri Lanka
  • Sweden
  • Switzerland
  • Taiwan
  • Thailand
  • Turkey
  • Ukraine
  • UAE
  • United Kingdom
  • United States
  • Venezuela
  • Vietnam
Antibodies.com Logo Antibodies.com Logo
Sign In/Register
0

Anti-Von Willebrand Factor Antibody [ARC52173] (A306677)

Immunohistochemistry - Anti-Von Willebrand Factor Antibody [ARC52173] (A306677) - Antibodies.com Immunohistochemistry - Anti-Von Willebrand Factor Antibody [ARC52173] (A306677) - Antibodies.com Immunohistochemistry - Anti-Von Willebrand Factor Antibody [ARC52173] (A306677) - Antibodies.com Immunohistochemistry - Anti-Von Willebrand Factor Antibody [ARC52173] (A306677) - Antibodies.com
$485
Product Datasheet

Rabbit monoclonal [ARC52173] antibody to Von Willebrand Factor for IHC.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 7-10 business days.

  • Specifications

Name
Anti-Von Willebrand Factor Antibody [ARC52173]
Description
Rabbit monoclonal [ARC52173] antibody to Von Willebrand Factor.
Applications
IHC
Dilutions
IHC: 1:500-1:1,000
Reactivity
Human, Mouse
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 2645-2813 of human von Willebrand factor (VWF) (NP_000543.3).
Sequence
LPTACTIQLRGGQIMTLKRDETLQDGCDTHFCKVNERGEYFWEKRVTGCPPFDEHKCLAEGGKIMKIPGTCCDTCEEPECNDITARLQYVKVGSCKSEVEVDIHYCQGKCASKAMYSIDINDVQDQCSCCSPTRTEPMQVALHCTNGSVVYHEVLNAMECKCSPRKCSK
Host
Rabbit
Clonality
Monoclonal
Clone ID
ARC52173
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Concentration
Lot Specific
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.
Synonyms
F8VWF
Isotype Controls
Suitable Secondaries
See all Anti-Rabbit IgG Secondaries →
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.

  • Scientific Validation DataValidation Data (4)

Immunohistochemistry - Anti-Von Willebrand Factor Antibody [ARC52173] (A306677) - Antibodies.comEnlarge Image

Immunohistochemistry - Anti-Von Willebrand Factor Antibody [ARC52173] (A306677)

Immunohistochemistry analysis of paraffin-embedded human colon tissue using Anti-Von Willebrand Factor Antibody [ARC52173] (A306677) at a dilution of 1:800 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-Von Willebrand Factor Antibody [ARC52173] (A306677) - Antibodies.comEnlarge Image

Immunohistochemistry - Anti-Von Willebrand Factor Antibody [ARC52173] (A306677)

Immunohistochemistry analysis of paraffin-embedded human tonsil using Anti-Von Willebrand Factor Antibody [ARC52173] (A306677) at a dilution of 1:800 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-Von Willebrand Factor Antibody [ARC52173] (A306677) - Antibodies.comEnlarge Image

Immunohistochemistry - Anti-Von Willebrand Factor Antibody [ARC52173] (A306677)

Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using Anti-Von Willebrand Factor Antibody [ARC52173] (A306677) at a dilution of 1:800 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-Von Willebrand Factor Antibody [ARC52173] (A306677) - Antibodies.comEnlarge Image

Immunohistochemistry - Anti-Von Willebrand Factor Antibody [ARC52173] (A306677)

Immunohistochemistry analysis of paraffin-embedded mouse lung using Anti-Von Willebrand Factor Antibody [ARC52173] (A306677) at a dilution of 1:800 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Publishing research using Anti-Von Willebrand Factor Antibody [ARC52173] (A306677)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-Von Willebrand Factor Antibody [ARC52173] (A306677)

slide 5 to 8 of 12
Antibodies.com Image Placeholder - Discover more for less
A282989
Anti-Von Willebrand Factor Antibody
Sheep polyclonal antibody to Von Willebrand Factor for ELISA, IHC-Fr, IF, Flow Cytometry and Immunodiffusion.
Immunohistochemistry - Anti-Von Willebrand Factor Antibody [3E2D10] (A250319) - Antibodies.com
(3)
A250320
Anti-Von Willebrand Factor Antibody [3E2D10]
Mouse monoclonal [3E2D10] antibody to Von Willebrand Factor for Flow Cytometry, IF, WB, IP and IHC-P.
Immunohistochemistry - Anti-Von Willebrand Factor Antibody [3E2D10] - BSA and Azide free (A253499) - Antibodies.com
(3)
A253500
Anti-Von Willebrand Factor Antibody [3E2D10] - BSA and Azide free
Mouse monoclonal [3E2D10] antibody to Von Willebrand Factor for Flow Cytometry, IF, WB, IP and IHC-P.
SDS-PAGE - Anti-Von Willebrand Factor Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free (A324297) - Antibodies.com
(2)
A324297
Anti-Von Willebrand Factor Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free
Recombinant chimeric monoclonal antibody to Von Willebrand Factor for ELISA, FACS, Functional Assay and In Vivo.
slide 5 to 8 of 12
Antibodies.com Image Placeholder - Discover more for less
A282989
Anti-Von Willebrand Factor Antibody
Sheep polyclonal antibody to Von Willebrand Factor for ELISA, IHC-Fr, IF, Flow Cytometry and Immunodiffusion.
Immunohistochemistry - Anti-Von Willebrand Factor Antibody [3E2D10] (A250319) - Antibodies.com
(3)
A250320
Anti-Von Willebrand Factor Antibody [3E2D10]
Mouse monoclonal [3E2D10] antibody to Von Willebrand Factor for Flow Cytometry, IF, WB, IP and IHC-P.
Immunohistochemistry - Anti-Von Willebrand Factor Antibody [3E2D10] - BSA and Azide free (A253499) - Antibodies.com
(3)
A253500
Anti-Von Willebrand Factor Antibody [3E2D10] - BSA and Azide free
Mouse monoclonal [3E2D10] antibody to Von Willebrand Factor for Flow Cytometry, IF, WB, IP and IHC-P.
SDS-PAGE - Anti-Von Willebrand Factor Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free (A324297) - Antibodies.com
(2)
A324297
Anti-Von Willebrand Factor Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free
Recombinant chimeric monoclonal antibody to Von Willebrand Factor for ELISA, FACS, Functional Assay and In Vivo.
See all Von Willebrand Factor Antibodies