+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
Antibodies.com Logo Antibodies.com Logo
Sign In/Register
0

Anti-VEGF Receptor 1 Antibody (A17185)

Western Blot - Anti-VEGF Receptor 1 Antibody (A17185) - Antibodies.com Immunohistochemistry - Anti-VEGF Receptor 1 Antibody (A17185) - Antibodies.com Immunohistochemistry - Anti-VEGF Receptor 1 Antibody (A17185) - Antibodies.com Immunohistochemistry - Anti-VEGF Receptor 1 Antibody (A17185) - Antibodies.com
$335
Product Datasheet

Rabbit polyclonal antibody to VEGF Receptor 1 for WB and IHC.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 5-8 business days.

  • Specifications

Name
Anti-VEGF Receptor 1 Antibody
Description
Rabbit polyclonal antibody to VEGF Receptor 1.
Applications
WB, IHC
Dilutions
WB: 1:500-1:2,000, IHC: 1:50-1:100
Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 20-300 of human VEGFR1 (NP_001153392.1).
Sequence
LTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
151 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
FLT, FLT-1, FLT1, Fms-like tyrosine kinase 1, FRT, Tyrosine-protein kinase FRT, Tyrosine-protein kinase receptor FLT, Vascular endothelial growth factor receptor 1, Vascular permeability factor receptor, VEGFR-1, VEGFR1
Isotype Controls
Suitable Secondaries
See all Anti-Rabbit IgG Secondaries →
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.

  • Scientific Validation DataValidation Data (4)

Western Blot - Anti-VEGF Receptor 1 Antibody (A17185) - Antibodies.comEnlarge Image

Western Blot - Anti-VEGF Receptor 1 Antibody (A17185)

Western blot analysis of extracts of various cell lines, using Anti-VEGF Receptor 1 Antibody (A17185) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Enhanced Kit (RM00021). Exposure time: 30s.
Immunohistochemistry - Anti-VEGF Receptor 1 Antibody (A17185) - Antibodies.comEnlarge Image

Immunohistochemistry - Anti-VEGF Receptor 1 Antibody (A17185)

Immunohistochemistry analysis of paraffin-embedded rat spleen using Anti-VEGF Receptor 1 Antibody (A17185) at a dilution of 1:100 (40x lens).
Immunohistochemistry - Anti-VEGF Receptor 1 Antibody (A17185) - Antibodies.comEnlarge Image

Immunohistochemistry - Anti-VEGF Receptor 1 Antibody (A17185)

Immunohistochemistry analysis of paraffin-embedded human placenta using Anti-VEGF Receptor 1 Antibody (A17185) at a dilution of 1:100 (40x lens).
Immunohistochemistry - Anti-VEGF Receptor 1 Antibody (A17185) - Antibodies.comEnlarge Image

Immunohistochemistry - Anti-VEGF Receptor 1 Antibody (A17185)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using Anti-VEGF Receptor 1 Antibody (A17185) at a dilution of 1:100 (40x lens).
Publishing research using Anti-VEGF Receptor 1 Antibody (A17185)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-VEGF Receptor 1 Antibody (A17185)

Western Blot - Anti-VEGF Receptor 1 Antibody (A12509) - Antibodies.com
(3)
A12509
Anti-VEGF Receptor 1 Antibody
Rabbit polyclonal antibody to VEGF Receptor 1 for WB and ICC/IF.
SDS-PAGE - Anti-VEGF Receptor 1 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free (A324288) - Antibodies.com
(2)
A324288
Anti-VEGF Receptor 1 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free
Recombinant human monoclonal antibody to VEGF Receptor 1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-VEGF Receptor 1 Antibody [FLT1/658] (A248570) - Antibodies.com
A248571
Anti-VEGF Receptor 1 Antibody [FLT1/658]
Mouse monoclonal [FLT1/658] antibody to VEGF Receptor 1 for Flow Cytometry, IF and Functional Studies.
Western Blot - Anti-VEGF Receptor 1 Antibody [ARC0363] (A307992) - Antibodies.com
(2)
A307992
Anti-VEGF Receptor 1 Antibody [ARC0363]
Rabbit monoclonal [ARC0363] antibody to VEGF Receptor 1 for WB.
ELISA - Icrucumab Biosimilar - Anti-VEGF Receptor 1 Antibody - BSA and Azide free (A318839) - Antibodies.com
(3)
A318839
Icrucumab Biosimilar - Anti-VEGF Receptor 1 Antibody - BSA and Azide free
Recombinant human monoclonal antibody to VEGF Receptor 1 for ELISA and Flow Cytometry.
SDS-PAGE - Anti-VEGF Receptor 1 Antibody [FLT1/1663] - BSA and Azide free (A278199) - Antibodies.com
A278199
Anti-VEGF Receptor 1 Antibody [FLT1/1663] - BSA and Azide free
Mouse monoclonal [FLT1/1663] antibody to VEGF Receptor 1 for Flow Cytometry, IF and Functional Studies.
SDS-PAGE - Anti-VEGF Receptor 1 Antibody [FLT1/658] - BSA and Azide free (A251752) - Antibodies.com
A251753
Anti-VEGF Receptor 1 Antibody [FLT1/658] - BSA and Azide free
Mouse monoclonal [FLT1/658] antibody to VEGF Receptor 1 for Flow Cytometry, IF and Functional Studies.
SDS-PAGE - Anti-VEGF Receptor 1 Antibody [FLT1/1663] (A277611) - Antibodies.com
A277611
Anti-VEGF Receptor 1 Antibody [FLT1/1663]
Mouse monoclonal [FLT1/1663] antibody to VEGF Receptor 1 for Flow Cytometry, IF and Functional Studies.
Antibodies.com Image Placeholder - Discover more for less
A323495
Icrucumab Biosimilar - Anti-VEGF Receptor 1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to VEGF Receptor 1 for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A324588
Anti-VEGF Receptor 1 Antibody [IHC086]
Rabbit monoclonal [IHC086] antibody to VEGF Receptor 1 for IHC-P.
Anti-VEGFR1 Antibody from FabGennix (VEGFR1-101AP) - Antibodies.com
A54530
Anti-VEGFR1 Antibody
Rabbit polyclonal antibody to VEGFR1 for ELISA, IHC, IP and WB.
Western blot - Flt-1 (Phospho-Tyr1333) Polyclonal Antibody from Signalway Antibody (12310) - Antibodies.com
A50268
Anti-Flt-1 (Phospho-Tyr1333) Antibody
Rabbit polyclonal antibody to Flt-1 (Phospho-Tyr1333) for WB, IHC and ELISA.
Western Blot - Anti-VEGF Receptor 1 Antibody (A12509) - Antibodies.com
(3)
A12509
Anti-VEGF Receptor 1 Antibody
Rabbit polyclonal antibody to VEGF Receptor 1 for WB and ICC/IF.
SDS-PAGE - Anti-VEGF Receptor 1 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free (A324288) - Antibodies.com
(2)
A324288
Anti-VEGF Receptor 1 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free
Recombinant human monoclonal antibody to VEGF Receptor 1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-VEGF Receptor 1 Antibody [FLT1/658] (A248570) - Antibodies.com
A248571
Anti-VEGF Receptor 1 Antibody [FLT1/658]
Mouse monoclonal [FLT1/658] antibody to VEGF Receptor 1 for Flow Cytometry, IF and Functional Studies.
Western Blot - Anti-VEGF Receptor 1 Antibody [ARC0363] (A307992) - Antibodies.com
(2)
A307992
Anti-VEGF Receptor 1 Antibody [ARC0363]
Rabbit monoclonal [ARC0363] antibody to VEGF Receptor 1 for WB.
ELISA - Icrucumab Biosimilar - Anti-VEGF Receptor 1 Antibody - BSA and Azide free (A318839) - Antibodies.com
(3)
A318839
Icrucumab Biosimilar - Anti-VEGF Receptor 1 Antibody - BSA and Azide free
Recombinant human monoclonal antibody to VEGF Receptor 1 for ELISA and Flow Cytometry.
SDS-PAGE - Anti-VEGF Receptor 1 Antibody [FLT1/1663] - BSA and Azide free (A278199) - Antibodies.com
A278199
Anti-VEGF Receptor 1 Antibody [FLT1/1663] - BSA and Azide free
Mouse monoclonal [FLT1/1663] antibody to VEGF Receptor 1 for Flow Cytometry, IF and Functional Studies.
SDS-PAGE - Anti-VEGF Receptor 1 Antibody [FLT1/658] - BSA and Azide free (A251752) - Antibodies.com
A251753
Anti-VEGF Receptor 1 Antibody [FLT1/658] - BSA and Azide free
Mouse monoclonal [FLT1/658] antibody to VEGF Receptor 1 for Flow Cytometry, IF and Functional Studies.
SDS-PAGE - Anti-VEGF Receptor 1 Antibody [FLT1/1663] (A277611) - Antibodies.com
A277611
Anti-VEGF Receptor 1 Antibody [FLT1/1663]
Mouse monoclonal [FLT1/1663] antibody to VEGF Receptor 1 for Flow Cytometry, IF and Functional Studies.
Antibodies.com Image Placeholder - Discover more for less
A323495
Icrucumab Biosimilar - Anti-VEGF Receptor 1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to VEGF Receptor 1 for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A324588
Anti-VEGF Receptor 1 Antibody [IHC086]
Rabbit monoclonal [IHC086] antibody to VEGF Receptor 1 for IHC-P.
Anti-VEGFR1 Antibody from FabGennix (VEGFR1-101AP) - Antibodies.com
A54530
Anti-VEGFR1 Antibody
Rabbit polyclonal antibody to VEGFR1 for ELISA, IHC, IP and WB.
Western blot - Flt-1 (Phospho-Tyr1333) Polyclonal Antibody from Signalway Antibody (12310) - Antibodies.com
A50268
Anti-Flt-1 (Phospho-Tyr1333) Antibody
Rabbit polyclonal antibody to Flt-1 (Phospho-Tyr1333) for WB, IHC and ELISA.
See all VEGF Receptor 1 Antibodies