Anti-TRAP220/MED1 Antibody (A13617)

Anti-TRAP220/MED1 Antibody

Rabbit polyclonal antibody to TRAP220/MED1.

WB: 1:500-1:1,000

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human MED1 (NP_004765.2).

MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIMYWKATNAGPLDKILHGSVGYLTPRSGGHLMNLKYYVSPSDLLDDKTASPIILHENNVSRSLGMNASVTIEGTSAVYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLP

Rabbit

Polyclonal

IgG

Lot Specific

250 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.

Activator-recruited cofactor 205 kDa component, ARC205, CRSP1, CRSP200, DRIP205, DRIP230, MED1, MED1_HUMAN, Mediator complex subunit 1, Mediator of RNA polymerase II transcription subunit 1, p53 regulatory protein RB18A, PBP, Peroxisome proliferator-activated receptor-binding protein, PPAR binding protein , PPAR-binding protein, PPARBP, PPARGBP, RB18A, Thyroid hormone receptor-associated protein complex 220 kDa component, Thyroid receptor-interacting protein 2, TR-interacting protein 2, Trap220, TRIP-2, TRIP2, Vitamin D receptor-interacting protein complex component DRIP205