+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
Antibodies.com Logo Antibodies.com Logo
Sign In/Register
0

Anti-SIRP alpha Antibody (A17252)

Western Blot - Anti-SIRP alpha Antibody (A17252) - Antibodies.com Immunofluorescence - Anti-SIRP alpha Antibody (A17252) - Antibodies.com Immunofluorescence - Anti-SIRP alpha Antibody (A17252) - Antibodies.com Immunofluorescence - Anti-SIRP alpha Antibody (A17252) - Antibodies.com
$335
Product Datasheet

Rabbit polyclonal antibody to SIRP alpha for WB and ICC/IF.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 5-8 business days.

  • Specifications

Name
Anti-SIRP alpha Antibody
Description
Rabbit polyclonal antibody to SIRP alpha.
Applications
WB, ICC/IF
Dilutions
WB: 1:500-1:2,000, ICC/IF: 1:50-1:200
Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 395-504 of human CD172a/SIRPa (NP_542970.1).
Sequence
RIRQKKAQGSTSSTRLHEPEKNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
65 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
BIT, Brain Ig-like molecule with tyrosine-based activation motifs, CD172 antigen-like family member A, CD172a, Inhibitory receptor SHPS-1, Macrophage fusion receptor, MFR, MyD-1 antigen, MYD1, PTPNS1, SHP substrate 1, SHPS-1, SHPS1, SIRP, SIRPA, Tyrosine-protein phosphatase non-receptor type substrate 1
Isotype Controls
Suitable Secondaries
See all Anti-Rabbit IgG Secondaries →
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.

  • Scientific Validation DataValidation Data (4)

Western Blot - Anti-SIRP alpha Antibody (A17252) - Antibodies.comEnlarge Image

Western Blot - Anti-SIRP alpha Antibody (A17252)

Western blot analysis of extracts of various cell lines, using Anti-SIRP alpha Antibody (A17252) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 1s.
Immunofluorescence - Anti-SIRP alpha Antibody (A17252) - Antibodies.comEnlarge Image

Immunofluorescence - Anti-SIRP alpha Antibody (A17252)

Immunofluorescence analysis of H9C2 cells using Anti-SIRP alpha Antibody (A17252) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).
Immunofluorescence - Anti-SIRP alpha Antibody (A17252) - Antibodies.comEnlarge Image

Immunofluorescence - Anti-SIRP alpha Antibody (A17252)

Immunofluorescence analysis of L929 cells using Anti-SIRP alpha Antibody (A17252) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).
Immunofluorescence - Anti-SIRP alpha Antibody (A17252) - Antibodies.comEnlarge Image

Immunofluorescence - Anti-SIRP alpha Antibody (A17252)

Immunofluorescence analysis of U2OS cells using Anti-SIRP alpha Antibody (A17252) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).
Publishing research using Anti-SIRP alpha Antibody (A17252)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-SIRP alpha Antibody (A17252)

Western Blot - Anti-Sirp alpha1 Antibody (C0322) - Antibodies.com
(2)
A94954
Anti-Sirp alpha1 Antibody
Rabbit polyclonal antibody to Sirp alpha1 for WB, IHC and ELISA.
SDS-PAGE - Anti-SIRP alpha Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free (A324240) - Antibodies.com
(4)
A324240
Anti-SIRP alpha Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free
Recombinant human monoclonal antibody to SIRP alpha for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A280253
Anti-SIRP alpha Antibody [DH59B]
Mouse monoclonal [DH59B] antibody to SIRP alpha for IHC-Fr and Flow Cytometry.
Western Blot - Anti-SIRP alpha Antibody [ARC1626] (A308467) - Antibodies.com
(3)
A308467
Anti-SIRP alpha Antibody [ARC1626]
Rabbit monoclonal [ARC1626] antibody to SIRP alpha for WB and ICC/IF.
Flow Cytometry - Anti-SIRP alpha Antibody [DM8] - Azide free (A318677) - Antibodies.com
(2)
A318677
Anti-SIRP alpha Antibody [DM8] - BSA and Azide free
Recombinant rabbit monoclonal [DM8] antibody to SIRP alpha for ELISA, Flow Cytometry, IF and IP.
SDS-PAGE - Anti-SIRP alpha Antibody [BI 765063] - Low endotoxin, Azide free (A324241) - Antibodies.com
(2)
A324241
Anti-SIRP alpha Antibody [BI 765063] - Low endotoxin, Azide free
Recombinant human monoclonal [BI 765063] antibody to SIRP alpha for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A279843
Anti-SIRP alpha Antibody [BL1H7]
Mouse monoclonal [BL1H7] antibody to SIRP alpha for WB, IHC-P, IP, Flow Cytometry and IHC-Fr.
Antibodies.com Image Placeholder - Discover more for less
A280341
Anti-SIRP alpha Antibody [ED9]
Mouse monoclonal [ED9] antibody to SIRP alpha for WB, IP, Flow Cytometry and IHC-Fr.
Antibodies.com Image Placeholder - Discover more for less
A281454
Anti-SIRP alpha Antibody [OX-41]
Mouse monoclonal [OX-41] antibody to SIRP alpha for WB, IHC-P, Flow Cytometry and IHC-Fr.
Antibodies.com Image Placeholder - Discover more for less
A283857
Anti-SIRP alpha Antibody
Rabbit polyclonal antibody to SIRP alpha for WB and IHC-Fr.
Flow Cytometry - Anti-CD172a Antibody [15-414] (A285850) - Antibodies.com
A285851
Anti-SIRP alpha Antibody [15-414]
Mouse monoclonal [15-414] antibody to SIRP alpha for Flow Cytometry.
Antibodies.com Image Placeholder - Discover more for less
A279025
Anti-SIRP alpha Antibody [15-414]
Mouse monoclonal [15-414] antibody to SIRP alpha for Flow Cytometry and IHC-Fr.
Western Blot - Anti-Sirp alpha1 Antibody (C0322) - Antibodies.com
(2)
A94954
Anti-Sirp alpha1 Antibody
Rabbit polyclonal antibody to Sirp alpha1 for WB, IHC and ELISA.
SDS-PAGE - Anti-SIRP alpha Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free (A324240) - Antibodies.com
(4)
A324240
Anti-SIRP alpha Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free
Recombinant human monoclonal antibody to SIRP alpha for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A280253
Anti-SIRP alpha Antibody [DH59B]
Mouse monoclonal [DH59B] antibody to SIRP alpha for IHC-Fr and Flow Cytometry.
Western Blot - Anti-SIRP alpha Antibody [ARC1626] (A308467) - Antibodies.com
(3)
A308467
Anti-SIRP alpha Antibody [ARC1626]
Rabbit monoclonal [ARC1626] antibody to SIRP alpha for WB and ICC/IF.
Flow Cytometry - Anti-SIRP alpha Antibody [DM8] - Azide free (A318677) - Antibodies.com
(2)
A318677
Anti-SIRP alpha Antibody [DM8] - BSA and Azide free
Recombinant rabbit monoclonal [DM8] antibody to SIRP alpha for ELISA, Flow Cytometry, IF and IP.
SDS-PAGE - Anti-SIRP alpha Antibody [BI 765063] - Low endotoxin, Azide free (A324241) - Antibodies.com
(2)
A324241
Anti-SIRP alpha Antibody [BI 765063] - Low endotoxin, Azide free
Recombinant human monoclonal [BI 765063] antibody to SIRP alpha for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A279843
Anti-SIRP alpha Antibody [BL1H7]
Mouse monoclonal [BL1H7] antibody to SIRP alpha for WB, IHC-P, IP, Flow Cytometry and IHC-Fr.
Antibodies.com Image Placeholder - Discover more for less
A280341
Anti-SIRP alpha Antibody [ED9]
Mouse monoclonal [ED9] antibody to SIRP alpha for WB, IP, Flow Cytometry and IHC-Fr.
Antibodies.com Image Placeholder - Discover more for less
A281454
Anti-SIRP alpha Antibody [OX-41]
Mouse monoclonal [OX-41] antibody to SIRP alpha for WB, IHC-P, Flow Cytometry and IHC-Fr.
Antibodies.com Image Placeholder - Discover more for less
A283857
Anti-SIRP alpha Antibody
Rabbit polyclonal antibody to SIRP alpha for WB and IHC-Fr.
Flow Cytometry - Anti-CD172a Antibody [15-414] (A285850) - Antibodies.com
A285851
Anti-SIRP alpha Antibody [15-414]
Mouse monoclonal [15-414] antibody to SIRP alpha for Flow Cytometry.
Antibodies.com Image Placeholder - Discover more for less
A279025
Anti-SIRP alpha Antibody [15-414]
Mouse monoclonal [15-414] antibody to SIRP alpha for Flow Cytometry and IHC-Fr.
See all SIRP alpha Antibodies