+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
Antibodies.com Logo Antibodies.com Logo
Sign In/Register
0

Anti-PD1 Antibody (A87674)

Western Blot - Anti-PD1 Antibody (A87674) - Antibodies.com Immunofluorescence - Anti-PD1 Antibody (A87674) - Antibodies.com
$335
Product Datasheet

Rabbit polyclonal antibody to PD1 for WB and ICC/IF.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 5-8 business days.

  • Specifications

Name
Anti-PD1 Antibody
Description
Rabbit polyclonal antibody to PD1.
Applications
WB, ICC/IF
Dilutions
WB: 1:500-1:1,000, ICC/IF: 1:50-1:200
Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 205-259 of human PD-1/CD279 (NP_005009.2).
Sequence
TGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGT
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
50 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
CD279, PDCD1, Programmed cell death protein 1, Protein PD-1
Isotype Controls
Suitable Secondaries
See all Anti-Rabbit IgG Secondaries →
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.

  • Scientific Validation DataValidation Data (2)

Western Blot - Anti-PD1 Antibody (A87674) - Antibodies.comEnlarge Image

Western Blot - Anti-PD1 Antibody (A87674)

Western blot analysis of extracts of various cell lines, using Anti-PD1 Antibody (A87674) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 1s.
Immunofluorescence - Anti-PD1 Antibody (A87674) - Antibodies.comEnlarge Image

Immunofluorescence - Anti-PD1 Antibody (A87674)

Immunofluorescence analysis of human tonsil cells using Anti-PD1 Antibody (A87674) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).
Publishing research using Anti-PD1 Antibody (A87674)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-PD1 Antibody (A87674)

SDS-PAGE - Pembrolizumab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free (A323657) - Antibodies.com
(4)
A323657
Pembrolizumab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to PD1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Camrelizumab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free (A323338) - Antibodies.com
(3)
A323338
Camrelizumab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to PD1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Serplulimab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free (A323730) - Antibodies.com
(3)
A323730
Serplulimab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PD1 for ELISA, FACS, Functional Assay and In Vivo.
Immunohistochemistry - Anti-PD1 Antibody [NAT105] (A249586) - Antibodies.com
(2)
A249587
Anti-PD1 Antibody [NAT105]
Mouse monoclonal [NAT105] antibody to PD1 for Flow Cytometry, IF and IHC-P.
SDS-PAGE - Sintilimab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free (A323738) - Antibodies.com
(3)
A323738
Sintilimab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PD1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Spartalizumab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free (A323748) - Antibodies.com
(3)
A323748
Spartalizumab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to PD1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Toripalimab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free (A323795) - Antibodies.com
(3)
A323795
Toripalimab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to PD1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Nivolumab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free (A323610) - Antibodies.com
(3)
A323610
Nivolumab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PD1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Nofazinlimab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free (A323611) - Antibodies.com
(2)
A323611
Nofazinlimab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PD1 for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A322631
Anti-PD1 Antibody [UMAB197]
Mouse monoclonal [UMAB197] antibody to PD1 for IF, IHC and WB.
Antibodies.com Image Placeholder - Discover more for less
A322630
Anti-PD1 Antibody [UMAB197] - BSA and Azide free
Mouse monoclonal [UMAB197] antibody to PD1 for IF, IHC and WB.
SDS-PAGE - Cetrelimab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free (A323352) - Antibodies.com
(2)
A323352
Cetrelimab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PD1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Pembrolizumab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free (A323657) - Antibodies.com
(4)
A323657
Pembrolizumab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to PD1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Camrelizumab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free (A323338) - Antibodies.com
(3)
A323338
Camrelizumab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to PD1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Serplulimab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free (A323730) - Antibodies.com
(3)
A323730
Serplulimab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PD1 for ELISA, FACS, Functional Assay and In Vivo.
Immunohistochemistry - Anti-PD1 Antibody [NAT105] (A249586) - Antibodies.com
(2)
A249587
Anti-PD1 Antibody [NAT105]
Mouse monoclonal [NAT105] antibody to PD1 for Flow Cytometry, IF and IHC-P.
SDS-PAGE - Sintilimab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free (A323738) - Antibodies.com
(3)
A323738
Sintilimab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PD1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Spartalizumab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free (A323748) - Antibodies.com
(3)
A323748
Spartalizumab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to PD1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Toripalimab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free (A323795) - Antibodies.com
(3)
A323795
Toripalimab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to PD1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Nivolumab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free (A323610) - Antibodies.com
(3)
A323610
Nivolumab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PD1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Nofazinlimab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free (A323611) - Antibodies.com
(2)
A323611
Nofazinlimab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PD1 for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A322631
Anti-PD1 Antibody [UMAB197]
Mouse monoclonal [UMAB197] antibody to PD1 for IF, IHC and WB.
Antibodies.com Image Placeholder - Discover more for less
A322630
Anti-PD1 Antibody [UMAB197] - BSA and Azide free
Mouse monoclonal [UMAB197] antibody to PD1 for IF, IHC and WB.
SDS-PAGE - Cetrelimab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free (A323352) - Antibodies.com
(2)
A323352
Cetrelimab Biosimilar - Anti-PD1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PD1 for ELISA, FACS, Functional Assay and In Vivo.
See all PD1 Antibodies