Anti-Parathyroid Hormone Antibody [BGN/1F8] (A279829)

Anti-Parathyroid Hormone Antibody [BGN/1F8]

Mouse monoclonal [BGN/1F8] antibody to Parathyroid Hormone.

This antibody recognises human parathyroid hormone (PTH) also known as Parathyrin. PTH is a hormone produced by the parathyroid gland responsible for the regulation of calcium and phosphorus concentrations in extracellular fluid (Brown 1983).Human parathyroid hormone is produced in the parathyroid gland as a 115 amino acid single chain polypeptide, bearing a 25 amino acid signal peptide, a 6 amino acid pro-peptide sequence and an 84 amino acid mature hormone. Defects in the PTH gene are a cause of familial isolated hypoparathyroidism (FIH), a condition characterized by hypocalcemia and hyperphosphatemia owing to levels of parathyroid hormone being insufficient to maintain extracellular calcium concentrations within normal parameters. Clinical features of FIH include cramps, seizures and tetany. More rarely, hypoparathyroidism like disease, Pseudohypothyroidism (PHP1A) may be caused by mutations in the GNAS gene or defects in the PTHR1 gene (Cohen 2002) leading to Jansen metaphyseal chondrodysplasia (JMC), conditions where end organ resistance to PTH function exists.

ELISA, IHC-Fr, IHC-P

ELISA: 1:2 000 - 1:20 000

Human, Rat, Mouse

Synthetic peptide corresponding to amino acids 1-34 of mature PTH conjugated to a proprietary carrier molecule.

MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVS

Mouse

Monoclonal

BGN/1F8

IgG1

1 mg/ml

Liquid

Supplied in Phosphate Buffered Saline with 0.09% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti Human parathyroid hormone monoclonal antibody, clone BGN/1F8 recognizes human parathyroid hormone (PTH) also known as Parathyrin. PTH is a hormone produced by the parathyroid gland responsible for the regulation of calcium and phosphorus concentrations in extracellular fluid (Brown 1983).Human parathyroid hormone is produced in the parathyroid gland as a 115 amino acid single chain polypeptide, bearing a 25 amino acid signal peptide, a 6 amino acid pro-peptide sequence and an 84 amino acid mature hormone. (Keutmann et al. 1978).Defects in the PTH gene are a cause of familial isolated hypoparathyroidism (FIH), a condition characterized by hypocalcemia and hyperphosphatemia owing to levels of parathyroid hormone being insufficient to maintain extracellular calcium concentrations within normal parameters. Clinical features of FIH include cramps, seizures and tetany (Arnold et al. 1990). More rarely, hypoparathyroidism like disease, Pseudohypothyroidism (PHP1A) may be caused by mutations in the GNAS gene (Mantovani & Spada 2006) or defects in the PTHR1 gene (Cohen 2002) leading to Jansen metaphyseal chondrodysplasia (JMC), conditions where end organ resistance to PTH function exists .

Parathormone, Parathyrin, PTH