+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
  • Argentina
  • Australia
  • Austria
  • Bahrain
  • Belgium
  • Brazil
  • Bulgaria
  • Cameroon
  • Canada
  • Chile
  • China
  • Colombia
  • Croatia
  • Cyprus
  • Czech Republic
  • Denmark
  • Ecuador
  • Egypt
  • Estonia
  • Finland
  • France
  • Germany
  • Greece
  • Hong Kong
  • Hungary
  • Iceland
  • India
  • Indonesia
  • Iran
  • Ireland
  • Israel
  • Italy
  • Japan
  • Kazakhstan
  • Kuwait
  • Latvia
  • Lithuania
  • Luxembourg
  • Macedonia
  • Malaysia
  • Malta
  • Mexico
  • Monaco
  • Morocco
  • Netherlands
  • New Zealand
  • Nigeria
  • Norway
  • Peru
  • Philippines
  • Poland
  • Portugal
  • Qatar
  • Romania
  • Russia
  • Saudi Arabia
  • Serbia
  • Singapore
  • Slovakia
  • Slovenia
  • South Africa
  • South Korea
  • Spain
  • Sri Lanka
  • Sweden
  • Switzerland
  • Taiwan
  • Thailand
  • Turkey
  • Ukraine
  • UAE
  • United Kingdom
  • United States
  • Venezuela
  • Vietnam
Antibodies.com Logo Antibodies.com Logo
Sign In/Register
0

Anti-Interferon alpha/beta receptor 1 Antibody [ARC0262] (A306495)

Western Blot - Anti-Interferon alpha/beta receptor 1 Antibody [ARC0262] (A306495) - Antibodies.com Western Blot - Anti-Interferon alpha/beta receptor 1 Antibody [ARC0262] (A306495) - Antibodies.com
$485
Product Datasheet

Rabbit monoclonal [ARC0262] antibody to Interferon alpha/beta receptor 1 for WB.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 7-10 business days.

  • Specifications

Name
Anti-Interferon alpha/beta receptor 1 Antibody [ARC0262]
Description
Rabbit monoclonal [ARC0262] antibody to Interferon alpha/beta receptor 1.
Applications
WB
Dilutions
WB: 1:500-1:2,000
Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 458-557 of human IFNAR1 (P17181).
Sequence
KVFLRCINYVFFPSLKPSSSIDEYFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV
Host
Rabbit
Clonality
Monoclonal
Clone ID
ARC0262
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Concentration
Lot Specific
Molecular Weight
49 kDa / 56 kDa / 63 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.
Synonyms
CRF2-1, Cytokine receptor class-II member 1, Cytokine receptor family 2 member 1, IFN-alpha/beta receptor 1, IFN-R-1, IFNAR, Type I interferon receptor 1
Isotype Controls
Suitable Secondaries
See all Anti-Rabbit IgG Secondaries →
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.

  • Scientific Validation DataValidation Data (2)

Western Blot - Anti-Interferon alpha/beta receptor 1 Antibody [ARC0262] (A306495) - Antibodies.comEnlarge Image

Western Blot - Anti-Interferon alpha/beta receptor 1 Antibody [ARC0262] (A306495)

Western blot analysis of extracts of various cell lines, using Anti-Interferon alpha/beta receptor 1 Antibody [ARC0262] (A306495) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 3min.
Western Blot - Anti-Interferon alpha/beta receptor 1 Antibody [ARC0262] (A306495) - Antibodies.comEnlarge Image

Western Blot - Anti-Interferon alpha/beta receptor 1 Antibody [ARC0262] (A306495)

Western blot analysis of extracts of various cell lines, using Anti-Interferon alpha/beta receptor 1 Antibody [ARC0262] (A306495) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Enhanced Kit (RM00021). Exposure time: 30s.
Publishing research using Anti-Interferon alpha/beta receptor 1 Antibody [ARC0262] (A306495)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-Interferon alpha/beta receptor 1 Antibody [ARC0262] (A306495)

slide 7 to 10 of 8
Western Blot - Anti-Interferon alpha/beta receptor 1 Antibody (A308248) - Antibodies.com
(6)
A308248
Anti-Interferon alpha/beta receptor 1 Antibody
Rabbit polyclonal antibody to Interferon alpha/beta receptor 1 for WB, IHC and ICC/IF.
SDS-PAGE - Anti-Interferon alpha/beta Receptor 1 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free (A323863) - Antibodies.com
(3)
A323863
Anti-Interferon alpha/beta Receptor 1 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free
Recombinant human monoclonal antibody to Interferon alpha/beta Receptor 1 for ELISA, FACS, Functional Assay and In Vivo.
ELISA - Anifrolumab Biosimilar - Anti-Interferon alpha/beta Receptor 1 Antibody - BSA and Azide free (A318850) - Antibodies.com
(4)
A318850
Anifrolumab Biosimilar - Anti-Interferon alpha/beta Receptor 1 Antibody - BSA and Azide free
Recombinant human monoclonal antibody to Interferon alpha/beta Receptor 1 for ELISA and Flow Cytometry.
SDS-PAGE - Anifrolumab Biosimilar - Anti-Interferon alpha/beta Receptor 1 Antibody - Low endotoxin, Azide free (A323283) - Antibodies.com
(3)
A323283
Anifrolumab Biosimilar - Anti-Interferon alpha/beta Receptor 1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to Interferon alpha/beta Receptor 1 for ELISA, FACS, Functional Assay and In Vivo.
slide 7 to 10 of 8
Western Blot - Anti-Interferon alpha/beta receptor 1 Antibody (A308248) - Antibodies.com
(6)
A308248
Anti-Interferon alpha/beta receptor 1 Antibody
Rabbit polyclonal antibody to Interferon alpha/beta receptor 1 for WB, IHC and ICC/IF.
SDS-PAGE - Anti-Interferon alpha/beta Receptor 1 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free (A323863) - Antibodies.com
(3)
A323863
Anti-Interferon alpha/beta Receptor 1 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free
Recombinant human monoclonal antibody to Interferon alpha/beta Receptor 1 for ELISA, FACS, Functional Assay and In Vivo.
ELISA - Anifrolumab Biosimilar - Anti-Interferon alpha/beta Receptor 1 Antibody - BSA and Azide free (A318850) - Antibodies.com
(4)
A318850
Anifrolumab Biosimilar - Anti-Interferon alpha/beta Receptor 1 Antibody - BSA and Azide free
Recombinant human monoclonal antibody to Interferon alpha/beta Receptor 1 for ELISA and Flow Cytometry.
SDS-PAGE - Anifrolumab Biosimilar - Anti-Interferon alpha/beta Receptor 1 Antibody - Low endotoxin, Azide free (A323283) - Antibodies.com
(3)
A323283
Anifrolumab Biosimilar - Anti-Interferon alpha/beta Receptor 1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to Interferon alpha/beta Receptor 1 for ELISA, FACS, Functional Assay and In Vivo.
See all Interferon alpha/beta receptor 1 Antibodies