Anti-IL-11 Antibody [C01-1C2] (A279923)

Anti-IL-11 Antibody [C01-1C2]

Mouse monoclonal [C01-1C2] antibody to IL-11.

This antibody recognises human interleukin-11 (IL-11), a 178 amino acid non-glycosylated pleiotropic cytokine, also known as AGIF. IL-11 is a 19 kDa member of the IL-6 of cytokines. It signals through a high affinity receptor complex, made up of the IL-11 receptor alpha chain (IL-11Ralpha) and gp130 which triggers homo- or hetero-dimerization of gp130. Although gp130 and its dimer partners possess no kinase activity, the dimerization of gp130 leads to activation of tyrosine kinases and modulation of transcriptional activity.IL-11 is an important regulator in the haematopoiesis of erythroid, myeloid and megakaryocyte progenitor cells and is expressed in a variety of tissues including the lung, bone, thymus and connective tissue. Expression of IL-11 in endometrial stromal cells is vital for normal murine embryo development, and implicated in decidualization during human pregnancy. IL-11 is a functionally diverse signalling molecule with roles in megakaryopoiesis , bone growth and T cell proliferation.

Human

E. coli derived recombinant protein corresponding to amino acids 23-125 of human IL-11.

GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPE

Mouse

Monoclonal

C01-1C2

IgG1

1 mg/ml

Liquid

Supplied in Phosphate Buffered Saline with <0.1% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti Human interleukin-11, clone C01-1C2, recognizes human interleukin-11 (IL-11), a 178 amino acid non-glycosylated pleiotropic cytokine, also known as AGIF. IL-11 is a 19 kDa member of the IL-6 of cytokines. It signals through a high affinity receptor complex, made up of the IL-11 receptor alpha chain (IL-11Ralpha) and gp130 which triggers homo- or hetero-dimerization of gp130. Although gp130 and its dimer partners possess no kinase activity, the dimerization of gp130 leads to activation of tyrosine kinases and modulation of transcriptional activity.IL-11 is an important regulator in the haematopoiesis of erythroid, myeloid and megakaryocyte progenitor cells and is expressed in a variety of tissues including the lung, bone, thymus and connective tissue. Expression of IL-11 in endometrial stromal cells is vital for normal murine embryo development, and implicated in decidualization during human pregnancy. IL-11 is a functionally diverse signalling molecule with roles in megakaryopoiesis (Dams-Kozlowska et al. 2013), bone growth (Sims et al. 2005) and T cell proliferation (Curti et al. 2002).

Adipogenesis inhibitory factor, AGIF, IL11, Interleukin-11