Anti-IKK alpha Antibody (A91358)

Anti-IKK alpha Antibody

Rabbit polyclonal antibody to IKK alpha.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 600-700 of human IKKa (NP_001269.3).

VLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTP

Rabbit

Polyclonal

IgG

85 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

CHUK, Conserved helix-loop-helix ubiquitous kinase, I-kappa-B kinase 1, I-kappa-B kinase alpha, IkappaB kinase, IkBKA, IKK-1, IKK-A, IKK-alpha, IKK1, IKKA, Inhibitor of nuclear factor kappa-B kinase subunit alpha, NFKBIKA, Nuclear factor NF-kappa-B inhibitor kinase alpha, TCF-16, TCF16, Transcription factor 16