Anti-Histone H2B Antibody [ARC2337] (A306466)

Anti-Histone H2B Antibody [ARC2337]

Rabbit monoclonal [ARC2337] antibody to Histone H2B.

WB, IHC

WB: 1:500-1:1,000, IHC: 1:50-1:200

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 47-126 of human Histone H2B (O60814).

KQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

Rabbit

Monoclonal

ARC2337

IgG

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

H2B K, H2B type 12, H2B-clustered histone 12 like, H2B-clustered histone 17, H2B-clustered histone 18, H2B-clustered histone 21, H2B-clustered histone 26, H2B-clustered histone 3, H2B-clustered histone 5, H2B-clustered histone 9, H2B.S histone 1, H2B.U histone 1, H2B/a, H2B/b, H2B/c, H2B/d, H2B/e, H2B/f, H2B/g, H2B/h, H2B/j, H2B/k, H2B/l, H2B/n, H2B/q, H2B/s, H2BC12, H2BC12L, H2BC13, H2BC14, H2BC15, H2BC17, H2BC18, H2BC21, H2BC26, H2BC3, H2BC4, H2BC5, H2BC9, H2BFB, H2BFC, H2BFD, H2BFE, H2BFF, H2BFH, H2BFJ, H2BFL, H2BFN, H2BFQ, H2BFS, H2BFT, H2BS1, H2BU1, HIRA-interacting protein 1, HIRA-interacting protein 2, HIRIP1, HIRIP2, HIST1H2BB, HIST1H2BC, HIST1H2BD, HIST1H2BH, HIST1H2BK, HIST1H2BL, HIST1H2BM, HIST1H2BN, HIST1H2BO, HIST2H2BE, HIST2H2BF, HIST3H2BB, Histone H2B type 1-B, Histone H2B type 1-C/E/F/G/I, Histone H2B type 1-D, Histone H2B type 1-H, Histone H2B type 1-K, Histone H2B type 1-L, Histone H2B type 1-M, Histone H2B type 1-N, Histone H2B type 1-O, Histone H2B type 2-E, Histone H2B type 2-F, Histone H2B type 3-B, Histone H2B type F-S, Histone H2B-GL105, Histone H2B.1, Histone H2B.1 A, Histone H2B.1 B, Histone H2B.2, Histone H2B.a, Histone H2B.b, Histone H2B.c, Histone H2B.d, Histone H2B.e, Histone H2B.f, Histone H2B.g, Histone H2B.h, Histone H2B.j, Histone H2B.k, Histone H2B.l, Histone H2B.n, Histone H2B.q, Histone H2B.s