+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
Antibodies.com Logo Antibodies.com Logo
Sign In/Register
0

Anti-Histone H1.0 Antibody [ARC1059] (A307908)

Western Blot - Anti-Histone H1.0 Antibody [ARC1059] (A307908) - Antibodies.com Immunohistochemistry - Anti-Histone H1.0 Antibody [ARC1059] (A307908) - Antibodies.com
$470
Product Datasheet

Rabbit monoclonal [ARC1059] antibody to Histone H1.0 for WB and IHC.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 5-8 business days.

  • Specifications

Name
Anti-Histone H1.0 Antibody [ARC1059]
Description
Rabbit monoclonal [ARC1059] antibody to Histone H1.0.
Applications
WB, IHC
Dilutions
WB: 1:500-1:2,000, IHC: 1:50-1:200
Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H1.0 (P07305).
Sequence
MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDE
Host
Rabbit
Clonality
Monoclonal
Clone ID
ARC1059
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
32 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
H1-0, H1-1, H1-10, H1-3, H1-5, H1-6, H1-8, H1F0, H1F1, H1F3, H1F5, H1FOO, H1FT, H1FV, H1FX, H1OO, H1T, HIST1H1A, HIST1H1B, HIST1H1D, HIST1H1T, Histone H1', Histone H1(0), Histone H1.1, Histone H1.10, Histone H1.3, Histone H1.5, Histone H1.8, Histone H1a, Histone H1b, Histone H1c, Histone H1oo, Histone H1s-2, Histone H1s-3, Histone H1t, Histone H1x, Oocyte-specific histone H1, Oocyte-specific linker histone H1, osH1, Testicular H1 histone
Isotype Controls
Suitable Secondaries
See all Anti-Rabbit IgG Secondaries →
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.

  • Scientific Validation DataValidation Data (2)

Western Blot - Anti-Histone H1.0 Antibody [ARC1059] (A307908) - Antibodies.comEnlarge Image

Western Blot - Anti-Histone H1.0 Antibody [ARC1059] (A307908)

Western blot analysis of extracts of various cell lines, using Anti-Histone H1.0 Antibody [ARC1059] (A307908) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry - Anti-Histone H1.0 Antibody [ARC1059] (A307908) - Antibodies.comEnlarge Image

Immunohistochemistry - Anti-Histone H1.0 Antibody [ARC1059] (A307908)

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using Anti-Histone H1.0 Antibody [ARC1059] (A307908) at a dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Publishing research using Anti-Histone H1.0 Antibody [ARC1059] (A307908)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-Histone H1.0 Antibody [ARC1059] (A307908)

Immunohistochemistry - Anti-Histone H1 Antibody [HH1/957] (A248805) - Antibodies.com
(11)
A248805
Anti-Histone H1 Antibody [HH1/957]
Mouse monoclonal [HH1/957] antibody to Histone H1 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [HH1/957] - BSA and Azide free (A251985) - Antibodies.com
(11)
A251985
Anti-Histone H1 Antibody [HH1/957] - BSA and Azide free
Mouse monoclonal [HH1/957] antibody to Histone H1 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [1415-1] (A248804) - Antibodies.com
(10)
A248804
Anti-Histone H1 Antibody [1415-1]
Mouse monoclonal [1415-1] antibody to Histone H1 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [1415-1] - BSA and Azide free (A251984) - Antibodies.com
(10)
A251984
Anti-Histone H1 Antibody [1415-1] - BSA and Azide free
Mouse monoclonal [1415-1] antibody to Histone H1 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [SPM256] (A248803) - Antibodies.com
(7)
A248803
Anti-Histone H1 Antibody [SPM256]
Mouse monoclonal [SPM256] antibody to Histone H1 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [SPM256] - BSA and Azide free (A251983) - Antibodies.com
(7)
A251983
Anti-Histone H1 Antibody [SPM256] - BSA and Azide free
Mouse monoclonal [SPM256] antibody to Histone H1 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [AE-4] (A248809) - Antibodies.com
(6)
A248809
Anti-Histone H1 Antibody [AE-4]
Recombinant rabbit monoclonal [AE-4] antibody to Histone H1 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [AE-4] - BSA and Azide free (A251989) - Antibodies.com
(6)
A251989
Anti-Histone H1 Antibody [AE-4] - BSA and Azide free
Recombinant rabbit monoclonal [AE-4] antibody to Histone H1 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [AE-4] - BSA and Azide free (A251982) - Antibodies.com
(7)
A251982
Anti-Histone H1 Antibody [AE-4] - BSA and Azide free
Mouse monoclonal [AE-4] antibody to Histone H1 for Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [r1415-1] (A248806) - Antibodies.com
(6)
A248806
Anti-Histone H1 Antibody [r1415-1]
Recombinant mouse monoclonal [r1415-1] antibody to Histone H1 for WB, Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [r1415-1] - BSA and Azide free (A251986) - Antibodies.com
(6)
A251986
Anti-Histone H1 Antibody [r1415-1] - BSA and Azide free
Recombinant mouse monoclonal [r1415-1] antibody to Histone H1 for WB, Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [AE-4] (A248802) - Antibodies.com
(7)
A248802
Anti-Histone H1 Antibody [AE-4]
Mouse monoclonal [AE-4] antibody to Histone H1 for Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [HH1/957] (A248805) - Antibodies.com
(11)
A248805
Anti-Histone H1 Antibody [HH1/957]
Mouse monoclonal [HH1/957] antibody to Histone H1 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [HH1/957] - BSA and Azide free (A251985) - Antibodies.com
(11)
A251985
Anti-Histone H1 Antibody [HH1/957] - BSA and Azide free
Mouse monoclonal [HH1/957] antibody to Histone H1 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [1415-1] (A248804) - Antibodies.com
(10)
A248804
Anti-Histone H1 Antibody [1415-1]
Mouse monoclonal [1415-1] antibody to Histone H1 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [1415-1] - BSA and Azide free (A251984) - Antibodies.com
(10)
A251984
Anti-Histone H1 Antibody [1415-1] - BSA and Azide free
Mouse monoclonal [1415-1] antibody to Histone H1 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [SPM256] (A248803) - Antibodies.com
(7)
A248803
Anti-Histone H1 Antibody [SPM256]
Mouse monoclonal [SPM256] antibody to Histone H1 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [SPM256] - BSA and Azide free (A251983) - Antibodies.com
(7)
A251983
Anti-Histone H1 Antibody [SPM256] - BSA and Azide free
Mouse monoclonal [SPM256] antibody to Histone H1 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [AE-4] (A248809) - Antibodies.com
(6)
A248809
Anti-Histone H1 Antibody [AE-4]
Recombinant rabbit monoclonal [AE-4] antibody to Histone H1 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [AE-4] - BSA and Azide free (A251989) - Antibodies.com
(6)
A251989
Anti-Histone H1 Antibody [AE-4] - BSA and Azide free
Recombinant rabbit monoclonal [AE-4] antibody to Histone H1 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [AE-4] - BSA and Azide free (A251982) - Antibodies.com
(7)
A251982
Anti-Histone H1 Antibody [AE-4] - BSA and Azide free
Mouse monoclonal [AE-4] antibody to Histone H1 for Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [r1415-1] (A248806) - Antibodies.com
(6)
A248806
Anti-Histone H1 Antibody [r1415-1]
Recombinant mouse monoclonal [r1415-1] antibody to Histone H1 for WB, Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [r1415-1] - BSA and Azide free (A251986) - Antibodies.com
(6)
A251986
Anti-Histone H1 Antibody [r1415-1] - BSA and Azide free
Recombinant mouse monoclonal [r1415-1] antibody to Histone H1 for WB, Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-Histone H1 Antibody [AE-4] (A248802) - Antibodies.com
(7)
A248802
Anti-Histone H1 Antibody [AE-4]
Mouse monoclonal [AE-4] antibody to Histone H1 for Flow Cytometry, IF and IHC-P.
See all Histone H1.0 Antibodies