Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Name: Anti-Heme Oxygenase 1 Antibody [ARC53508]
Brand: Antibodies.com
SKU: A307278
Price: 485.0 USD
Availability: InStock

Enlarge Image

$485

Rabbit monoclonal [ARC53508] antibody to Heme Oxygenase 1 for WB, IHC and IP.

100% Guarantee

Price Match Guarantee

Shipping Information

Freight/Packing Charges: $40

Dispatched from St. Louis, MO.

Lead Time: 7-10 business days.

Tags:

Knockout Validated Antibody

Specifications

Name

Anti-Heme Oxygenase 1 Antibody [ARC53508]

Description

Rabbit monoclonal [ARC53508] antibody to Heme Oxygenase 1.

Applications

WB, IHC, IP

Dilutions

WB: 1:2,000-1:10,000, IHC: 1:50-1:200, IP: 1:500-1:1,000

Reactivity

Human, Mouse, Rat

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-265 of human Heme Oxygenase 1 (HO-1/HMOX1) (NP_002124.1).

Sequence

MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQA

Host

Rabbit

Clonality

Monoclonal

Clone ID

ARC53508

Isotype

IgG

Conjugate

Unconjugated

Purification

Affinity purification.

Concentration

Lot Specific

Molecular Weight

33 kDa

Product Form

Liquid

Formulation

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.

Storage

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.

Synonyms

HMOX1, HO, HO-1, HO1

Isotype Controls

Suitable Secondaries

See all Anti-Rabbit IgG Secondaries →

Disclaimer

This product is for research use only. It is not intended for diagnostic or therapeutic use.

Scientific Validation DataValidation Data (10)

Enlarge Image

Western Blot - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Western blot analysis of extracts of various cell lines, using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at 1:500 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.

Enlarge Image

Western Blot - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Western blot analysis of extracts of Raw264. 7 cells, using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at 1:10,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 3s.

Enlarge Image

Western Blot - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Western blot analysis of extracts of HepG2 cells, using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at 1:10,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 180s.

Enlarge Image

Western Blot - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Western blot analysis of extracts from wild type(WT) and Heme Oxygenase 1 (HO-1/HMOX1) knockout (KO) HeLa cells, using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at 1:10,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 180s.

Enlarge Image

Immunohistochemistry - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Immunohistochemistry analysis of paraffin-embedded human liver using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Immunohistochemistry - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Immunohistochemistry analysis of paraffin-embedded human lung using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Immunohistochemistry - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Immunohistochemistry analysis of paraffin-embedded human tonsil using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Immunohistochemistry - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Immunohistochemistry analysis of paraffin-embedded mouse liver using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Immunohistochemistry - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Immunohistochemistry analysis of paraffin-embedded rat lung using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Western Blot - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Immunoprecipitation analysis of 300µg extracts of HepG2 cells using 3µg of Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278). This Western blot was performed on the immunoprecipitate using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at a dilution of 1:1000.

Show more images

Publishing research using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)? Please let us know so that we can list the citation on this page.