Anti-DPP4 Antibody [ARC0939] (A308878)

Anti-DPP4 Antibody [ARC0939]

Rabbit monoclonal [ARC0939] antibody to DPP4.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 667-766 of human CD26/DPP4 (P27487).

TERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP

Rabbit

Monoclonal

ARC0939

IgG

Affinity purification.

105 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ADABP, ADCP-2, ADCP2, Adenosine deaminase complexing protein 2, C-type lectin domain family 13 member D, C-type lectin domain family 13 member D-like, CD206, CLEC13D, CLEC13DL, Dipeptidyl peptidase 4, Dipeptidyl peptidase IV, DPP IV, hMR, Human mannose receptor, Macrophage mannose receptor 1, Macrophage mannose receptor 1-like protein 1, MMR, MRC1, MRC1L1, T-cell activation antigen CD26, TP103