+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
  • Argentina
  • Australia
  • Austria
  • Bahrain
  • Belgium
  • Brazil
  • Bulgaria
  • Cameroon
  • Canada
  • Chile
  • China
  • Colombia
  • Croatia
  • Cyprus
  • Czech Republic
  • Denmark
  • Ecuador
  • Egypt
  • Estonia
  • Finland
  • France
  • Germany
  • Greece
  • Hong Kong
  • Hungary
  • Iceland
  • India
  • Indonesia
  • Iran
  • Ireland
  • Israel
  • Italy
  • Japan
  • Kazakhstan
  • Kuwait
  • Latvia
  • Lithuania
  • Luxembourg
  • Macedonia
  • Malaysia
  • Malta
  • Mexico
  • Monaco
  • Morocco
  • Netherlands
  • New Zealand
  • Nigeria
  • Norway
  • Peru
  • Philippines
  • Poland
  • Portugal
  • Qatar
  • Romania
  • Russia
  • Saudi Arabia
  • Serbia
  • Singapore
  • Slovakia
  • Slovenia
  • South Africa
  • South Korea
  • Spain
  • Sri Lanka
  • Sweden
  • Switzerland
  • Taiwan
  • Thailand
  • Turkey
  • Ukraine
  • UAE
  • United Kingdom
  • United States
  • Venezuela
  • Vietnam
Antibodies.com Logo Antibodies.com Logo
Sign In/Register
0

Anti-CD137 Antibody (A91573)

Western Blot - Anti-CD137 Antibody (A91573) - Antibodies.com Immunohistochemistry - Anti-CD137 Antibody (A91573) - Antibodies.com Immunohistochemistry - Anti-CD137 Antibody (A91573) - Antibodies.com Immunohistochemistry - Anti-CD137 Antibody (A91573) - Antibodies.com
$355
Product Datasheet

Rabbit polyclonal antibody to CD137 for WB and IHC.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 7-10 business days.

  • Specifications

Name
Anti-CD137 Antibody
Description
Rabbit polyclonal antibody to CD137.
Applications
WB, IHC
Dilutions
WB: 1:500-1:2,000, IHC: 1:50-1:200
Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 24-186 of human 4-1BB/CD137 (NP_001552.2).
Sequence
LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Concentration
Lot Specific
Molecular Weight
27 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.
Synonyms
4-1BB ligand receptor, CDw137, ILA, T-cell antigen 4-1BB homolog, T-cell antigen ILA, TNFRSF9, Tumor necrosis factor receptor superfamily member 9
Isotype Controls
Suitable Secondaries
See all Anti-Rabbit IgG Secondaries →
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.

  • Scientific Validation DataValidation Data (4)

Western Blot - Anti-CD137 Antibody (A91573) - Antibodies.comEnlarge Image

Western Blot - Anti-CD137 Antibody (A91573)

Western blot analysis of extracts of various cell lines, using Anti-CD137 Antibody (A91573) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 60s.
Immunohistochemistry - Anti-CD137 Antibody (A91573) - Antibodies.comEnlarge Image

Immunohistochemistry - Anti-CD137 Antibody (A91573)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using Anti-CD137 Antibody (A91573) at a dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-CD137 Antibody (A91573) - Antibodies.comEnlarge Image

Immunohistochemistry - Anti-CD137 Antibody (A91573)

Immunohistochemistry analysis of paraffin-embedded rat spleen using Anti-CD137 Antibody (A91573) at a dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-CD137 Antibody (A91573) - Antibodies.comEnlarge Image

Immunohistochemistry - Anti-CD137 Antibody (A91573)

Immunohistochemistry analysis of paraffin-embedded human spleen using Anti-CD137 Antibody (A91573) at a dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Publishing research using Anti-CD137 Antibody (A91573)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-CD137 Antibody (A91573)

slide 5 to 8 of 12
Immunohistochemistry - Anti-CD137 Antibody [4-1BB/3201] (A249029) - Antibodies.com
(8)
A249029
Anti-CD137 Antibody [4-1BB/3201]
Mouse monoclonal [4-1BB/3201] antibody to CD137 for ELISA, IF, Flow Cytometry, WB and IHC-P.
Immunohistochemistry - Anti-CD137 Antibody [4-1BB/3201] - BSA and Azide free (A252209) - Antibodies.com
(8)
A252209
Anti-CD137 Antibody [4-1BB/3201] - BSA and Azide free
Mouse monoclonal [4-1BB/3201] antibody to CD137 for ELISA, IF, Flow Cytometry, WB and IHC-P.
SDS-PAGE - Urelumab Biosimilar - Anti-CD137 Antibody - Low endotoxin, Azide free (A323815) - Antibodies.com
(4)
A323815
Urelumab Biosimilar - Anti-CD137 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to CD137 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Utomilumab Biosimilar - Anti-CD137 Antibody - Low endotoxin, Azide free (A323816) - Antibodies.com
(3)
A323816
Utomilumab Biosimilar - Anti-CD137 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to CD137 for ELISA, FACS, Functional Assay and In Vivo.
slide 5 to 8 of 12
Immunohistochemistry - Anti-CD137 Antibody [4-1BB/3201] (A249029) - Antibodies.com
(8)
A249029
Anti-CD137 Antibody [4-1BB/3201]
Mouse monoclonal [4-1BB/3201] antibody to CD137 for ELISA, IF, Flow Cytometry, WB and IHC-P.
Immunohistochemistry - Anti-CD137 Antibody [4-1BB/3201] - BSA and Azide free (A252209) - Antibodies.com
(8)
A252209
Anti-CD137 Antibody [4-1BB/3201] - BSA and Azide free
Mouse monoclonal [4-1BB/3201] antibody to CD137 for ELISA, IF, Flow Cytometry, WB and IHC-P.
SDS-PAGE - Urelumab Biosimilar - Anti-CD137 Antibody - Low endotoxin, Azide free (A323815) - Antibodies.com
(4)
A323815
Urelumab Biosimilar - Anti-CD137 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to CD137 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Utomilumab Biosimilar - Anti-CD137 Antibody - Low endotoxin, Azide free (A323816) - Antibodies.com
(3)
A323816
Utomilumab Biosimilar - Anti-CD137 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to CD137 for ELISA, FACS, Functional Assay and In Vivo.
See all CD137 Antibodies