+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
  • Argentina
  • Australia
  • Austria
  • Bahrain
  • Belgium
  • Brazil
  • Bulgaria
  • Cameroon
  • Canada
  • Chile
  • China
  • Colombia
  • Croatia
  • Cyprus
  • Czech Republic
  • Denmark
  • Ecuador
  • Egypt
  • Estonia
  • Finland
  • France
  • Germany
  • Greece
  • Hong Kong
  • Hungary
  • Iceland
  • India
  • Indonesia
  • Iran
  • Ireland
  • Israel
  • Italy
  • Japan
  • Kazakhstan
  • Kuwait
  • Latvia
  • Lithuania
  • Luxembourg
  • Macedonia
  • Malaysia
  • Malta
  • Mexico
  • Monaco
  • Morocco
  • Netherlands
  • New Zealand
  • Nigeria
  • Norway
  • Peru
  • Philippines
  • Poland
  • Portugal
  • Qatar
  • Romania
  • Russia
  • Saudi Arabia
  • Serbia
  • Singapore
  • Slovakia
  • Slovenia
  • South Africa
  • South Korea
  • Spain
  • Sri Lanka
  • Sweden
  • Switzerland
  • Taiwan
  • Thailand
  • Turkey
  • Ukraine
  • UAE
  • United Kingdom
  • United States
  • Venezuela
  • Vietnam
Antibodies.com Logo Antibodies.com Logo
Sign In/Register
0

Anti-Amyloid Precursor Protein Antibody (A80556)

Immunofluorescence - Anti-Amyloid Precursor Protein Antibody (A80556) - Antibodies.com
$355
Product Datasheet

Rabbit polyclonal antibody to Amyloid Precursor Protein for ICC/IF.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 7-10 business days.

  • Specifications

Name
Anti-Amyloid Precursor Protein Antibody
Description
Rabbit polyclonal antibody to Amyloid Precursor Protein.
Applications
ICC/IF
Dilutions
ICC/IF: 1:50-1:200
Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human APP (NP_000475.1).
Sequence
MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKR
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Concentration
Lot Specific
Molecular Weight
100 - 140 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.
Synonyms
A4, ABPP, AD1, Alzheimer disease amyloid A4 protein homolog, Alzheimer disease amyloid protein, Amyloid-beta precursor protein, APPI
Isotype Controls
Suitable Secondaries
See all Anti-Rabbit IgG Secondaries →
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.

  • Scientific Validation DataValidation Data (1)

Immunofluorescence - Anti-Amyloid Precursor Protein Antibody (A80556) - Antibodies.comEnlarge Image

Immunofluorescence - Anti-Amyloid Precursor Protein Antibody (A80556)

Immunofluorescence analysis of HeLa cells using Anti-Amyloid Precursor Protein Antibody (A80556) at a dilution of 1:100. DAPI was used to stain the cell nuclei (blue).
Publishing research using Anti-Amyloid Precursor Protein Antibody (A80556)? Please let us know so that we can list the citation on this page.

Most popular Anti-Amyloid Precursor Protein Antibodies

slide 3 to 6 of 2
Endogenous expression of APP in mouse P19 cells during neural differentiation was analyzed by Western blotting using this antibody (ref.2).
(2)
A448
Anti-Amyloid Precursor Protein Antibody
Rabbit polyclonal antibody to Amyloid Precursor Protein for WB, ICC and IHC.
Western blot analysis of Amyloid Precursor Protein in the crude extract of mouse embryo with anti-APP N-teminua antibody (AN2).
(2)
A449
Anti-Amyloid Precursor Protein Antibody
Rabbit polyclonal antibody to Amyloid Precursor Protein for WB and ICC.
Endogenous expression of APP in mouse P19 cells during neural differentiation was analyzed by Western blotting using this antibody (ref.2).
(2)
A448
Anti-Amyloid Precursor Protein Antibody
Rabbit polyclonal antibody to Amyloid Precursor Protein for WB, ICC and IHC.
Western blot analysis of Amyloid Precursor Protein in the crude extract of mouse embryo with anti-APP N-teminua antibody (AN2).
(2)
A449
Anti-Amyloid Precursor Protein Antibody
Rabbit polyclonal antibody to Amyloid Precursor Protein for WB and ICC.
slide 3 to 6 of 2
Endogenous expression of APP in mouse P19 cells during neural differentiation was analyzed by Western blotting using this antibody (ref.2).
(2)
A448
Anti-Amyloid Precursor Protein Antibody
Rabbit polyclonal antibody to Amyloid Precursor Protein for WB, ICC and IHC.
Western blot analysis of Amyloid Precursor Protein in the crude extract of mouse embryo with anti-APP N-teminua antibody (AN2).
(2)
A449
Anti-Amyloid Precursor Protein Antibody
Rabbit polyclonal antibody to Amyloid Precursor Protein for WB and ICC.
Endogenous expression of APP in mouse P19 cells during neural differentiation was analyzed by Western blotting using this antibody (ref.2).
(2)
A448
Anti-Amyloid Precursor Protein Antibody
Rabbit polyclonal antibody to Amyloid Precursor Protein for WB, ICC and IHC.
Western blot analysis of Amyloid Precursor Protein in the crude extract of mouse embryo with anti-APP N-teminua antibody (AN2).
(2)
A449
Anti-Amyloid Precursor Protein Antibody
Rabbit polyclonal antibody to Amyloid Precursor Protein for WB and ICC.

Alternative products to Anti-Amyloid Precursor Protein Antibody (A80556)

slide 5 to 8 of 12
Western Blot - Anti-Amyloid Precursor Protein Antibody [ARC0465] (A307112) - Antibodies.com
(7)
A307112
Anti-Amyloid Precursor Protein Antibody [ARC0465]
Rabbit monoclonal [ARC0465] antibody to Amyloid Precursor Protein for WB, IHC, ICC/IF and IP.
Western Blot - Anti-Amyloid Precursor Protein Antibody (A87840) - Antibodies.com
(2)
A87840
1 Citation
Anti-Amyloid Precursor Protein Antibody
Rabbit polyclonal antibody to Amyloid Precursor Protein for WB and ICC/IF.
Antibodies.com Image Placeholder - Discover more for less
A283878
Anti-Amyloid Precursor Protein Antibody
Rabbit polyclonal antibody to Amyloid Precursor Protein for WB and IHC-P.
Western Blot - Anti-Amyloid Precursor Protein (phospho Thr668) Antibody (A16396) - Antibodies.com
(2)
A16396
Anti-Amyloid Precursor Protein (phospho Thr668) Antibody
Rabbit polyclonal antibody to Amyloid Precursor Protein (phospho Thr668) for WB.
slide 5 to 8 of 12
Western Blot - Anti-Amyloid Precursor Protein Antibody [ARC0465] (A307112) - Antibodies.com
(7)
A307112
Anti-Amyloid Precursor Protein Antibody [ARC0465]
Rabbit monoclonal [ARC0465] antibody to Amyloid Precursor Protein for WB, IHC, ICC/IF and IP.
Western Blot - Anti-Amyloid Precursor Protein Antibody (A87840) - Antibodies.com
(2)
A87840
1 Citation
Anti-Amyloid Precursor Protein Antibody
Rabbit polyclonal antibody to Amyloid Precursor Protein for WB and ICC/IF.
Antibodies.com Image Placeholder - Discover more for less
A283878
Anti-Amyloid Precursor Protein Antibody
Rabbit polyclonal antibody to Amyloid Precursor Protein for WB and IHC-P.
Western Blot - Anti-Amyloid Precursor Protein (phospho Thr668) Antibody (A16396) - Antibodies.com
(2)
A16396
Anti-Amyloid Precursor Protein (phospho Thr668) Antibody
Rabbit polyclonal antibody to Amyloid Precursor Protein (phospho Thr668) for WB.
See all Amyloid Precursor Protein Antibodies