+1 (314) 370-6046 or
Contact Us
  • Argentina
  • Australia
  • Austria
  • Bahrain
  • Belgium
  • Brazil
  • Bulgaria
  • Cameroon
  • Canada
  • Chile
  • China
  • Colombia
  • Croatia
  • Cyprus
  • Czech Republic
  • Denmark
  • Ecuador
  • Egypt
  • Estonia
  • Finland
  • France
  • Germany
  • Greece
  • Hong Kong
  • Hungary
  • Iceland
  • India
  • Indonesia
  • Iran
  • Ireland
  • Israel
  • Italy
  • Japan
  • Kazakhstan
  • Kuwait
  • Latvia
  • Lithuania
  • Luxembourg
  • Macedonia
  • Malaysia
  • Malta
  • Mexico
  • Monaco
  • Morocco
  • Netherlands
  • New Zealand
  • Nigeria
  • Norway
  • Peru
  • Philippines
  • Poland
  • Portugal
  • Qatar
  • Romania
  • Russia
  • Saudi Arabia
  • Serbia
  • Singapore
  • Slovakia
  • Slovenia
  • South Africa
  • South Korea
  • Spain
  • Sri Lanka
  • Sweden
  • Switzerland
  • Taiwan
  • Thailand
  • Turkey
  • Ukraine
  • UAE
  • United Kingdom
  • United States
  • Venezuela
  • Vietnam

Anti-Adiponectin Antibody [5H7] (A279452)

$495

Mouse monoclonal [5H7] antibody to Adiponectin for ELISA and WB.

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 5-7 business days.
Name
Anti-Adiponectin Antibody [5H7]
Description
Mouse monoclonal [5H7] antibody to Adiponectin.
Specificity
This antibody recognises the collagen-like domain of human adiponectin, also known as Acrp30, Gelatin-binding protein, Adipose most abundant gene transcript 1 protein, Adipocyte complement-related 30 kDa protein or apM-1. Adiponectin a 244 amino acid ~30 kDa major adipokine secreted into the bloodstream from adipose tissue into the circulation where it exists as three distinct, low, medium and high molecular weight oligomeric forms (UniProt: Q15848).Circulating adiponectin levels are correlated with insulin sensitivity and decreased levels parallel the change in insulin sensitivity during the progression to type II diabetes. Mutations in the adiponectin gene can also lead to adiponectin deficiency characterized by obesity, diabetes, high blood pressure and circulating cholesterol. Mouse anti Human adiponectin, clone 5H7 had been used successfully as a detection reagent in the development of sensitive sandwich ELISA's in conjunction with Mouse anti Human adiponectin, clone Adn27 (MCA4652) or Mouse anti Human adiponectin antibody, clone Adn36 (MCA4653) as capture reagents.
Applications
ELISA, WB
Dilutions
WB: 1:1,000 - 1:2,000
Reactivity
Human, Mouse
Immunogen
Recombinant human adiponectin (amino acids 15-244) purified from E. coli .
Sequence
GHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Host
Mouse
Clonality
Monoclonal
Clone ID
5H7
Isotype
IgG1
Conjugate

Unconjugated

Purification
Protein G affinity chromatography of ascites.
Concentration
1 mg/ml
Molecular Weight
Approximately 64 kDa in mouse liver cell lysates.
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline with 10% Glycerol and 0.02% Sodium Azide.
Storage
Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.
General Notes
Mouse anti Human adiponectin, clone 5H7 recognizes the collagen-like domain of human adiponectin, also known as Acrp30, Gelatin-binding protein, Adipose most abundant gene transcript 1 protein, Adipocyte complement-related 30 kDa protein or apM-1. Adiponectin a 244 amino acid ~30 kDa major adipokine secreted into the bloodstream from adipose tissue into the circulation where it exists as three distinct, low, medium and high molecular weight oligomeric forms (UniProt: Q15848).Circulating adiponectin levels are correlated with insulin sensitivity and decreased levels parallel the change in insulin sensitivity during the progression to type II diabetes (Heilbronn et al. 2011). Mutations in the adiponectin gene can also lead to adiponectin deficiency characterized by obesity, diabetes, high blood pressure and circulating cholesterol (Takahashi et al. 2000).Mouse anti Human adiponectin, clone 5H7 had been used successfully as a detection reagent in the development of sensitive sandwich ELISA's in conjunction with Mouse anti Human adiponectin, clone Adn27 (MCA4652) or Mouse anti Human adiponectin antibody, clone Adn36 (MCA4653) as capture reagents.
Synonyms
30 kDa adipocyte complement-related protein, ACDC, ACRP30, Adipocyte complement-related 30 kDa protein, Adipocyte, C1q and collagen domain-containing protein, ADIPOQ, Adipose most abundant gene transcript 1 protein, apM-1, APM1, GBP28, Gelatin-binding protein
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Publishing research using Anti-Adiponectin Antibody [5H7] (A279452)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-Adiponectin Antibody [5H7] (A279452)