Anti-Calpain 2 Antibody [ARC0891] (A306767)

Anti-Calpain 2 Antibody [ARC0891]

Rabbit monoclonal [ARC0891] antibody to Calpain 2.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 600-700 of human Calpain 2 (P17655).

LWTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIIDFDNFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL

Rabbit

Monoclonal

ARC0891

IgG

Unconjugated

80 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Calcium activated neutral proteinase, Calcium activated neutral proteinase 2, Calcium-activated neutral protease 2, catalytic subunit, Calcium-activated neutral proteinase 2, CALP80, Calpain 2 (m/II) large subunit, Calpain 2 catalytic subunit, Calpain 2 large catalytic subunit, Calpain 2 large subunit, Calpain 2, large [catalytic] subunit, Calpain large polypeptide L2, Calpain M type, Calpain M-type, Calpain-2 catalytic subunit, Calpain-2 large subunit, Calpain2, CAN2_HUMAN, CANP 2, CANP L2, CANP2, CANPL 2, CANPL2, CANPml, Capa2, CAPN 2, CAPN2, FLJ39928, M calpain, M calpin, M type, M-calpain, mCANP, Millimolar calpain, Millimolar-calpain