Anti-c-Jun Antibody (A93087)

Anti-c-Jun Antibody

Rabbit polyclonal antibody to c-Jun.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 150-250 of human c-Jun (NP_002219.1).

VAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQ

Rabbit

Polyclonal

IgG

Unconjugated

36 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Activator protein 1, AP 1, AP1, cJun, Enhancer Binding Protein AP1, JUN, Jun Activation Domain Binding Protein, Jun oncogene, JUN protein, Jun proto oncogene, JUNC, JUN_HUMAN, Oncogene JUN, p39, Proto oncogene c jun, Proto oncogene cJun, Proto-oncogene c-jun, Transcription Factor AP 1, Transcription factor AP-1, Transcription Factor AP1, V jun avian sarcoma virus 17 oncogene homolog, V jun sarcoma virus 17 oncogene homolog, V jun sarcoma virus 17 oncogene homolog (avian), V-jun avian sarcoma virus 17 oncogene homolog, vJun Avian Sarcoma Virus 17 Oncogene Homolog