Anti-BMPR1A Antibody (A13676)

Anti-BMPR1A Antibody

Rabbit polyclonal antibody to BMPR1A.

WB: 1:500-1:1,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 24-200 of human BMPR1A (NP_004320.2).

QNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRWLVLLISMAVCIIAMIIFSSCFCYKHYCKSISSRRRYNRDLEQDEAFI

Rabbit

Polyclonal

IgG

Unconjugated

60 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

10q23del, Activin A receptor type II like kinase 3, Activin receptor like kinase 3, Activin receptor-like kinase 3, ACVRLK 3, ACVRLK3, ALK 3, ALK-3, ALK3, BMP type-1A receptor, Bmpr, BMPR 1A, BMPR-1A, BMPR1A/ALK3, BMR1A_HUMAN, Bone morphogenetic protein receptor type IA, Bone morphogenetic protein receptor type IA precursor, Bone morphogenetic protein receptor type-1A, BR 1a, BR1a, CD 292, CD292, CD292 antigen, EC 2.7.11.30, Serine threonine protein kinase receptor R5, Serine threonine protein kinase receptor R5 precursor, Serine/threonine-protein kinase receptor R5, SKR 5, SKR5, zBMPR IA, zBMPRIA