Anti-B7H4 Antibody (A12928)

Anti-B7H4 Antibody

Rabbit polyclonal antibody to B7H4.

WB: 1:500-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 100-260 of human B7-H4/VTCN1 (NP_078902.2).

RTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASL

Rabbit

Polyclonal

IgG

Unconjugated

36 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

B7 family member, H4, B7 H4, B7 homolog 4, B7 superfamily member 1, B7 superfamily, member 1, B7-H4, B7h.5, B7S1, B7x, BC032925, Immune costimulatory protein B7-H4, Immune costimulatory protein B7H4, MGC41287, PRO1291, Protein B7S1, RP11 229A19.4, T cell costimulatory molecule B7x, T-cell costimulatory molecule B7x, V set domain-containing T cell activation inhibitor 1, V-set domain-containing T-cell activation inhibitor 1, VCTN1, Vtcn1, VTCN1_HUMAN