Anti-Aspartate Aminotransferase Antibody (A283720)

Anti-Aspartate Aminotransferase Antibody

Rabbit polyclonal antibody to Aspartate Aminotransferase.

This antibody recognises glutamate oxaloacetate transaminase 1 (GOT1), also known as aspartate aminotransferase, cysteine aminotransferase cytoplasmic, cCAT and transaminase A. It coordinates the carbohydrate and amino acid metabolism. GOT1 supports long-term cell proliferation in KRAS mutated cancers.

WB, IHC-P

IHC-P: 1:50 - 1:200, WB: 1:500 - 1:2,000

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 244-413 of human GOT1.

FVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ

Rabbit

Polyclonal

IgG

Lot Specific

Approximately 42 kDa in various cell lysates under reducing conditions

Liquid

Supplied in Phosphate Buffered Saline with 50% Glycerol and 0.02% Sodium Azide.

Store undiluted at -20°C. Storage in frost free freezers is not recommended. Avoid freeze-thaw cycles. Should this product contain a precipitate we recommend microcentrifugation before use.

Rabbit anti GOT1 antibody recognizes glutamate oxaloacetate transaminase 1 (GOT1), also known as aspartate aminotransferase, cysteine aminotransferase cytoplasmic, cCAT and transaminase A. It coordinates the carbohydrate and amino acid metabolism (Zhou et al. 2018). GOT1 supports long-term cell proliferation in KRAS mutated cancers (Son et al. 2013).

Aspartate aminotransferase, cytoplasmic, cAspAT, cCAT, Cysteine aminotransferase, cytoplasmic, Cysteine transaminase, cytoplasmic, Glutamate oxaloacetate transaminase 1, Transaminase A