Anti-AMH Antibody [5/6] (A278857)

Anti-AMH Antibody [5/6]

Mouse monoclonal [5/6] antibody to AMH.

This antibody recognises human anti-mullerian hormone (AMH), originally classified as a foetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth.AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric ~140 kDa disulphide linked precursor that is cleaved to release the mature ~30 kDa homodimer.

WB, IHC-P

IHC-P 1: 1:20 - 1:40

Human, Mouse, Sheep, Squirrel monkey, Baboon

Synthetic peptide sequence VPTAYAGKLLISLSEERISAHHVPNMVATEC from human AMH.

VPTAYAGKLLISLSEERISAHHVPNMVATEC

Mouse

Monoclonal

5/6

IgG1

Lot Specific

Liquid

Supplied in 0.1 M TRIS with HCl, pH 7.4, 5-10% FBS and 0.1% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti Human AMH, clone 5/6 recognizes human anti-mullerian hormone (AMH), originally classified as a foetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth.AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric ~140 kDa disulphide linked precursor that is cleaved to release the mature ~30 kDa homodimer.

Anti muellerian hormone, MIF, MIS, Muellerian inhibiting factor, Mullerian inhibiting substance