Anti-Alpha-synuclein Antibody (A15598)

Anti-Alpha-synuclein Antibody

Rabbit polyclonal antibody to Alpha-synuclein.

WB, ICC/IF

WB: 1:500-1:1,000, ICC/IF: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 59-140 of human alpha-Synuclein (NP_000336.1).

TKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Alpha synuclein, Alpha-synuclein, isoform NACP140, alphaSYN, MGC105443, MGC110988, MGC127560, MGC64356, NACP, Non A beta component of AD amyloid, Non A4 component of amyloid, Non A4 component of amyloid precursor, Non-A beta component of AD amyloid, Non-A-beta component of alzheimers disease amyloid , precursor of, Non-A4 component of amyloid precursor, Non-A4 component of amyloid, precursor of, OTTHUMP00000218549, OTTHUMP00000218551, OTTHUMP00000218552, OTTHUMP00000218553, OTTHUMP00000218554, PARK 1, PARK 4, PARK1, PARK4, Parkinson disease (autosomal dominant, Lewy body) 4, Parkinson disease familial 1, SNCA, Snca synuclein, alpha (non A4 component of amyloid precursor), SYN, Synuclein alpha, Synuclein alpha 140, Synuclein, alpha (non A4 component of amyloid precursor), SYUA_HUMAN