Anti-ADAM33 Antibody (A10372)

Anti-ADAM33 Antibody

Rabbit polyclonal antibody to ADAM33.

WB: 1:500-1:2000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 500-700 of human ADAM33 (NP_001269376.1).

YLLDGSPCARGSGYCWDGACPTLEQQCQQLWGPGSHPAPEACFQVVNSAGDAHGNCGQDSEGHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLDGQEVTCRGALALPSAQLDLLGLGLVEPGTQCGPRMVCQSRRCRKNAFQELQRCLTACHSHGVCNSNHNCHCAPGWAPPFCDKPGFGGSMDSGPVQAENHD

Rabbit

Polyclonal

IgG

Affinity purification.

87kDa

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

A disintegrin and metalloprotease 33, A disintegrin and metalloproteinase domain 33, ADA33_HUMAN, ADAM 33, ADAM metallopeptidase domain 33, C20orf153, Disintegrin and metalloproteinase domain-containing protein 33, Disintegrin and reprolysin metalloproteinase family protein, DJ964F7.1, DKFZp434K0521, FLJ35308, FLJ36751, Metalloprotease disintegrin, MGC149823, MGC71889, PRO1891, UNQ873